Protein Info for b3473 in Escherichia coli BW25113

Name: yhhS
Annotation: putative transport (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 109 to 140 (32 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 350 (326 residues), 92.9 bits, see alignment E=1e-30 amino acids 256 to 400 (145 residues), 46.4 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 100% identical to YHHS_ECOLI: Uncharacterized MFS-type transporter YhhS (yhhS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3473)

Predicted SEED Role

"Transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37621 at UniProt or InterPro

Protein Sequence (405 amino acids)

>b3473 putative transport (VIMSS) (Escherichia coli BW25113)
MPEPVAEPALNGLRLNLRIVSIVMFNFASYLTIGLPLAVLPGYVHDVMGFSAFWAGLVIS
LQYFATLLSRPHAGRYADSLGPKKIVVFGLCGCFLSGLGYLTAGLTASLPVISLLLLCLG
RVILGIGQSFAGTGSTLWGVGVVGSLHIGRVISWNGIVTYGAMAMGAPLGVVFYHWGGLQ
ALALIIMGVALVAILLAIPRPTVKASKGKPLPFRAVLGRVWLYGMALALASAGFGVIATF
ITLFYDAKGWDGAAFALTLFSCAFVGTRLLFPNGINRIGGLNVAMICFSVEIIGLLLVGV
ATMPWMAKIGVLLAGAGFSLVFPALGVVAVKAVPQQNQGAALATYTVFMDLSLGVTGPLA
GLVMSWAGVPVIYLAAAGLVAIALLLTWRLKKRPPEHVPEAASSS