Protein Info for b3465 in Escherichia coli BW25113
Name: yhhF
Annotation: predicted methyltransferase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RSMD_ECOL6: Ribosomal RNA small subunit methyltransferase D (rsmD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 100% identity to eco:b3465)MetaCyc: 100% identical to 16S rRNA m2G966 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6515 [EC: 2.1.1.171]
Predicted SEED Role
No annotation
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.1.1.171
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0ADX9 at UniProt or InterPro
Protein Sequence (198 amino acids)
>b3465 predicted methyltransferase (NCBI) (Escherichia coli BW25113) MKKPNHSGSGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCF AGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQKGTP HNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAG QVAYRLYQREAQGESDAD