Protein Info for b3414 in Escherichia coli BW25113

Name: gntY
Annotation: predicted gluconate transport associated protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR03341: IscR-regulated protein YhgI" amino acids 2 to 191 (190 residues), 332.5 bits, see alignment E=3.9e-104 PF01521: Fe-S_biosyn" amino acids 2 to 99 (98 residues), 51.3 bits, see alignment E=1.3e-17 PF01106: NifU" amino acids 111 to 177 (67 residues), 68.6 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 100% identical to NFUA_SHISS: Fe/S biogenesis protein NfuA (nfuA) from Shigella sonnei (strain Ss046)

KEGG orthology group: K07400, Fe/S biogenesis protein NfuA (inferred from 100% identity to eco:b3414)

MetaCyc: 100% identical to iron-sulfur cluster carrier protein NfuA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NfuA Fe-S protein maturation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P63020 at UniProt or InterPro

Protein Sequence (191 amino acids)

>b3414 predicted gluconate transport associated protein (NCBI) (Escherichia coli BW25113)
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDL
LTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQIN
PQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDL
TEHQRGEHSYY