Protein Info for b3412 in Escherichia coli BW25113

Name: bioH
Annotation: carboxylesterase of pimeloyl-CoA synthesis (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR01738: pimelyl-[acyl-carrier protein] methyl ester esterase" amino acids 10 to 252 (243 residues), 406.5 bits, see alignment E=2.1e-126 PF00561: Abhydrolase_1" amino acids 15 to 242 (228 residues), 147.7 bits, see alignment E=9.8e-47 PF00975: Thioesterase" amino acids 15 to 179 (165 residues), 27.4 bits, see alignment E=7.7e-10 PF12146: Hydrolase_4" amino acids 16 to 214 (199 residues), 40.9 bits, see alignment E=3.2e-14 PF12697: Abhydrolase_6" amino acids 16 to 246 (231 residues), 72.9 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 100% identical to BIOH_ECODH: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 100% identity to eco:b3412)

MetaCyc: 100% identical to pimeloyl-acyl carrier protein methyl ester esterase (Escherichia coli K-12 substr. MG1655)
RXN-11483 [EC: 3.1.1.85]; Carboxylesterase. [EC: 3.1.1.85, 3.1.1.1]

Predicted SEED Role

"Biotin synthesis protein BioH"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1 or 3.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P13001 at UniProt or InterPro

Protein Sequence (256 amino acids)

>b3412 carboxylesterase of pimeloyl-CoA synthesis (NCBI) (Escherichia coli BW25113)
MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALS
LADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGI
KPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGL
EILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFIS
HPAEFCHLLVALKQRV