Protein Info for b3410 in Escherichia coli BW25113
Name: yhgG
Annotation: predicted DNA-binding transcriptional regulator (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to FEOC_ECO5E: Probable [Fe-S]-dependent transcriptional repressor (feoC) from Escherichia coli O157:H7 (strain EC4115 / EHEC)
KEGG orthology group: K07490, ferrous iron transport protein C (inferred from 100% identity to eco:b3410)Predicted SEED Role
"Ferrous iron-sensisng transcriptional regulator FeoC" in subsystem Transport of Iron
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P64638 at UniProt or InterPro
Protein Sequence (78 amino acids)
>b3410 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113) MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGS CKSCPEGKACLREWWALR