Protein Info for b3410 in Escherichia coli BW25113

Name: yhgG
Annotation: predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 PF09012: FeoC" amino acids 4 to 69 (66 residues), 48.4 bits, see alignment E=7.8e-17 PF01978: TrmB" amino acids 11 to 53 (43 residues), 26.2 bits, see alignment E=5.8e-10

Best Hits

Swiss-Prot: 100% identical to FEOC_ECO5E: Probable [Fe-S]-dependent transcriptional repressor (feoC) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K07490, ferrous iron transport protein C (inferred from 100% identity to eco:b3410)

Predicted SEED Role

"Ferrous iron-sensisng transcriptional regulator FeoC" in subsystem Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P64638 at UniProt or InterPro

Protein Sequence (78 amino acids)

>b3410 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGS
CKSCPEGKACLREWWALR