Protein Info for b3395 in Escherichia coli BW25113
Name: yrfD
Annotation: orf, hypothetical protein (VIMSS)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
Swiss-Prot: 100% identical to HOFM_ECOLI: DNA utilization protein HofM (hofM) from Escherichia coli (strain K12)
KEGG orthology group: K12288, pilus assembly protein HofM (inferred from 100% identity to eco:b3395)Predicted SEED Role
"Type IV pilus biogenesis protein PilM" in subsystem Type IV pilus
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P45753 at UniProt or InterPro
Protein Sequence (259 amino acids)
>b3395 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113) MAFKIWQIGLHLQQQEAVAVAIVRGAKECFLQRWWRLPLENDIIKDGRIVDAQQLAKTLL PWSRELPQRHHIMLAFPASRTLQRSFPRPSMSLGEREQTAWLSGTMARELDMDPDSLRFD YSEDSLSPAYNVTAAQSKELATLLTLAERLRVHVSAITPDASALQRFLPFLPSHQQCLAW RDNEQWLWATRYSWGRKLAVGMTSAKELAAALSVDPESVAICGEGGFDPWEAVSVRQPPL PPPGGDFAIALGLALGKAY