Protein Info for b3394 in Escherichia coli BW25113

Name: yrfC
Annotation: predicted fimbrial assembly protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details PF05137: PilN" amino acids 99 to 166 (68 residues), 37 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 100% identical to HOFN_ECOLI: DNA utilization protein HofN (hofN) from Escherichia coli (strain K12)

KEGG orthology group: K12289, pilus assembly protein HofN (inferred from 100% identity to eco:b3394)

Predicted SEED Role

"Type IV pilus biogenesis protein PilN" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P64634 at UniProt or InterPro

Protein Sequence (179 amino acids)

>b3394 predicted fimbrial assembly protein (NCBI) (Escherichia coli BW25113)
MNPPINFLPWRQQRRTAFLRFWLLMFVAPLLLAVGITLILRLTGSAEARIDAVLLQAEQQ
LARSLQITKPRLLEQQQLREQRSQRQRQRQFTRDWQSALEALAALLPEHAWLTTISWQQG
TLEIKGLTTSITALNALETSLRQDASFHLNQRGATQQDAQGRWQFEYQLTRKVSDEHVL