Protein Info for b3388 in Escherichia coli BW25113

Name: damX
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 103 to 124 (22 residues), see Phobius details PF05036: SPOR" amino acids 345 to 418 (74 residues), 53.2 bits, see alignment E=1.5e-18

Best Hits

Swiss-Prot: 100% identical to DAMX_ECOLI: Cell division protein DamX (damX) from Escherichia coli (strain K12)

KEGG orthology group: K03112, DamX protein (inferred from 100% identity to eco:b3388)

Predicted SEED Role

"DamX, an inner membrane protein involved in bile resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P11557 at UniProt or InterPro

Protein Sequence (428 amino acids)

>b3388 hypothetical protein (NCBI) (Escherichia coli BW25113)
MDEFKPEDELKPDPSDRRTGRSRQSSERSERTERGEPQINFDDIELDDTDDRRPTRAQKE
RNEEPEIEEEIDESEDETVDEERVERRPRKRKKAASKPASRQYMMMGVGILVLLLLIIGI
GSALKAPSTTSSDQTASGEKSIDLAGNATDQANGVQPAPGTTSAENTQQDVSLPPISSTP
TQGQTPVATDGQQRVEVQGDLNNALTQPQNQQQLNNVAVNSTLPTEPATVAPVRNGNASR
DTAKTQTAERPSTTRPARQQAVIEPKKPQATVKTEPKPVAQTPKRTEPAAPVASTKAPAA
TSTPAPKETATTAPVQTASPAQTTATPAAGAKTAGNVGSLKSAPSSHYTLQLSSSSNYDN
LNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPL
RQVQADLK