Protein Info for b3371 in Escherichia coli BW25113

Name: yhfN
Annotation: putative transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 303 to 322 (20 residues), see Phobius details PF01380: SIS" amino acids 43 to 160 (118 residues), 34.3 bits, see alignment E=9.5e-13

Best Hits

Swiss-Prot: 100% identical to FRLB_SHIFL: Fructoselysine 6-phosphate deglycase (frlB) from Shigella flexneri

KEGG orthology group: K10708, fructoselysine 6-phosphate deglycase [EC: 3.5.-.-] (inferred from 100% identity to eco:b3371)

MetaCyc: 100% identical to fructoselysine 6-phosphate deglycase (Escherichia coli K-12 substr. MG1655)
RXN0-963

Predicted SEED Role

"Fructoselysine 6-phosphate deglycase (EC 3.5.-.-)" (EC 3.5.-.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.-.-

Use Curated BLAST to search for 3.5.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AC00 at UniProt or InterPro

Protein Sequence (340 amino acids)

>b3371 putative transport protein (VIMSS) (Escherichia coli BW25113)
MLDIDKSTVDFLVTENMVQEVEKVLSHDVPLVHAIVEEMVKRDIDRIYFVACGSPLNAAQ
TAKHLADRFSDLQVYAISGWEFCDNTPYRLDDRCAVIGVSDYGKTEEVIKALELGRACGA
LTAAFTKRADSPITSAAEFSIDYQADCIWEIHLLLCYSVVLEMITRLAPNAEIGKIKNDL
KQLPNALGHLVRTWEEKGRQLGELASQWPMIYTVAAGPLRPLGYKEGIVTLMEFTWTHGC
VIESGEFRHGPLEIVEPGVPFLFLLGNDESRHTTERAINFVKQRTDNVIVIDYAEISQGL
HPWLAPFLMFVPMEWLCYYLSIYKDHNPDERRYYGGLVEY