Protein Info for b3370 in Escherichia coli BW25113

Name: yhfM
Annotation: putative amino acid/amine transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 273 to 300 (28 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details PF13520: AA_permease_2" amino acids 10 to 410 (401 residues), 205.5 bits, see alignment E=1.5e-64 PF00324: AA_permease" amino acids 15 to 440 (426 residues), 115 bits, see alignment E=3.7e-37

Best Hits

Swiss-Prot: 100% identical to FRLA_ECOLI: Probable fructoselysine/psicoselysine transporter FrlA (frlA) from Escherichia coli (strain K12)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 100% identity to eco:b3370)

MetaCyc: 100% identical to fructoselysine/psicoselysine transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-417; TRANS-RXN0-418

Predicted SEED Role

"Fructoselysine transporter FrlA, cationic amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45539 at UniProt or InterPro

Protein Sequence (445 amino acids)

>b3370 putative amino acid/amine transport protein (VIMSS) (Escherichia coli BW25113)
MGSQELQRKLGFWAVLAIAVGTTVGSGIFVSVGEVAKAAGTPWLTVLAFVIGGLIVIPQM
CVYAELSTAYPENGADYVYLKNAGSRPLAFLSGWASFWANDAPSLSIMALAIVSNLGFLT
PIDPLLGKFIAAGLIIAFMLLHLRSVEGGAAFQTLITIAKIIPFTIVIGLGIFWFKAENF
AAPTTTAIGATGSFMALLAGISATSWSYTGMASICYMTGEIKNPGKTMPRALIGSCLLVL
VLYTLLALVISGLMPFDKLANSETPISDALTWIPALGSTAGIFVAITAMIVILGSLSSCV
MYQPRLEYAMAKDNLFFKCFGHVHPKYNTPDVSIILQGALGIFFIFVSDLTSLLGYFTLV
MCFKNTLTFGSIIWCRKRDDYKPLWRTPAFGLMTTLAIASSLILVASTFVWAPIPGLICA
VIVIATGLPAYAFWAKRSRQLNALS