Protein Info for b3366 in Escherichia coli BW25113

Name: nirD
Annotation: nitrite reductase small subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02378: nitrite reductase [NAD(P)H], small subunit
  • amino acids 3 to 107 (105 residues), 137.6 bits, E=7.6e-45
• PF13806: Rieske_2
  • amino acids 3 to 106 (104 residues), 139.4 bits, E=1.9e-45

Best Hits

Swiss-Prot: 100% identical to NIRD_ECO57: Nitrite reductase (NADH) small subunit (nirD) from Escherichia coli O157:H7

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 100% identity to eco:b3366)

MetaCyc: 100% identical to nitrite reductase (NADH) small subunit (Escherichia coli K-12 substr. MG1655)
RXN-13854 [EC: 1.7.1.15]

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

• alkylnitronates degradation (1/2 steps found)
• nitrate reduction V (assimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.15 or 1.7.1.4

Sequence Analysis Tools

See P0A9I8 at UniProt or InterPro

Protein Sequence (108 amino acids)

>b3366 nitrite reductase small subunit (NCBI) (Escherichia coli BW25113)
MSQWKDICKIDDILPETGVCALLGDEQVAIFRPYHSDQVFAISNIDPFFESSVLSRGLIA
EHQGELWVASPLKKQRFRLSDGLCMEDEQFSVKHYEARVKDGVVQLRG