Protein Info for b3364 in Escherichia coli BW25113

Name: tsgA
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 321 (308 residues), 82.9 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 100% identical to TSGA_ECO24: Protein TsgA (tsgA) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K06141, MFS transporter, TsgA protein (inferred from 100% identity to eco:b3364)

Predicted SEED Role

"TsgA protein homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60778 at UniProt or InterPro

Protein Sequence (393 amino acids)

>b3364 hypothetical protein (NCBI) (Escherichia coli BW25113)
MTNSNRIKLTWISFLSYALTGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISI
FLNAWLMEIVPLKTQLRFGFLLMVLAVAGLMFSHSLALFSAAMFILGVVSGITMSIGTFL
VTQMYEGRQRGSRLLFTDSFFSMAGMIFPMIAAFLLARSIEWYWVYACIGLVYVAIFILT
FGCEFPALGKHAPKTDAPVEKEKWGIGVLFLSVAALCYILGQLGFISWVPEYAKGLGMSL
NDAGTLVSNFWMSYMVGMWAFSFILRFFDLQRILTVLAGLAAILMYVFNTGTPAHMAWSI
LALGFFSSAIYTTIITLGSQQTKVPSPKLVNFVLTCGTIGTMLTFVVTGPIVEHSGPQAA
LLTANGLYAVVFVMCFLLGFVSRHRQHNTLTSH