Protein Info for b3325 in Escherichia coli BW25113

Name: yheF
Annotation: putative general protein secretion protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 30 to 604 (575 residues), 648.2 bits, see alignment E=6.3e-199 PF21305: type_II_gspD_N0" amino acids 31 to 100 (70 residues), 85.1 bits, see alignment E=3.6e-28 PF03958: Secretin_N" amino acids 127 to 186 (60 residues), 52.9 bits, see alignment 5.3e-18 amino acids 193 to 262 (70 residues), 62.5 bits, see alignment E=5.2e-21 amino acids 268 to 347 (80 residues), 55.9 bits, see alignment E=6.3e-19 PF00263: Secretin" amino acids 433 to 595 (163 residues), 172.6 bits, see alignment E=8.4e-55

Best Hits

Swiss-Prot: 100% identical to GSPD_ECOLI: Putative secretin GspD (gspD) from Escherichia coli (strain K12)

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to eco:b3325)

MetaCyc: 100% identical to type II secretion system protein GspD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45758 at UniProt or InterPro

Protein Sequence (650 amino acids)

>b3325 putative general protein secretion protein (VIMSS) (Escherichia coli BW25113)
MKGLNKITCCLLAALLMPCAGHAENEQYGANFNNADIRQFVEIVGQHLGKTILIDPSVQG
TISVRSNDTFSQQEYYQFFLSILDLYGYSVITLDNGFLKVVRSANVKTSPGMIADSSRPG
VGDELVTRIVPLENVPARDLAPLLRQMMDAGSVGNVVHYEPSNVLILTGRASTINKLIEV
IKRVDVIGTEKQQIIHLEYASAEDLAEILNQLISESHGKSQMPALLSAKIVADKRTNSLI
ISGPEKARQRITSLLKSLDVEESEEGNTRVYYLKYAKATNLVEVLTGVSEKLKDEKGNAR
KPSSSGAMDNVAITADEQTNSLVITADQSVQEKLATVIARLDIRRAQVLVEAIIVEVQDG
NGLNLGVQWANKNVGAQQFTNTGLPIFNAAQGVADYKKNGGITSANPAWDMFSAYNGMAA
GFFNGDWGVLLTALASNNKNDILATPSIVTLDNKLASFNVGQDVPVLSGSQTTSGDNVFN
TVERKTVGTKLKVTPQVNEGDAVLLEIEQEVSSVDSSSNSTLGPTFNTRTIQNAVLVKTG
ETVVLGGLLDDFSKEQVSKVPLLGDIPLVGQLFRYTSTERAKRNLMVFIRPTIIRDDDVY
RSLSKEKYTRYRQEQQQRIDGKSKALVGSEDLPVLDENTFNSHAPAPSSR