Protein Info for b3292 in Escherichia coli BW25113

Name: zntR
Annotation: zinc-responsive transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR02043: Zn(II)-responsive transcriptional regulator" amino acids 1 to 131 (131 residues), 206.2 bits, see alignment E=8.4e-66 PF13411: MerR_1" amino acids 2 to 69 (68 residues), 77.1 bits, see alignment E=1.3e-25 PF00376: MerR" amino acids 3 to 40 (38 residues), 50 bits, see alignment E=3.1e-17 PF09278: MerR-DNA-bind" amino acids 45 to 110 (66 residues), 76.9 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 100% identical to ZNTR_ECO57: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli O157:H7

KEGG orthology group: K13638, MerR family transcriptional regulator, Zn(II)-responsive regulator of zntA (inferred from 100% identity to eco:b3292)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACS5 at UniProt or InterPro

Protein Sequence (141 amino acids)

>b3292 zinc-responsive transcriptional regulator (NCBI) (Escherichia coli BW25113)
MYRIGELAKMAEVTPDTIRYYEKQQMMEHEVRTEGGFRLYTESDLQRLKFIRHARQLGFS
LESIRELLSIRIDPEHHTCQESKGIVQERLQEVEARIAELQSMQRSLQRLNDACCGTAHS
SVYCSILEALEQGASGVKSGC