Protein Info for b3284 in Escherichia coli BW25113

Name: smg
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF04361: DUF494" amino acids 1 to 157 (157 residues), 199.2 bits, see alignment E=1.7e-63

Best Hits

Swiss-Prot: 100% identical to SMG_SHIFL: Protein Smg (smg) from Shigella flexneri

KEGG orthology group: K03747, Smg protein (inferred from 100% identity to eco:b3284)

Predicted SEED Role

"Protein of unknown function Smg" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A828 at UniProt or InterPro

Protein Sequence (157 amino acids)

>b3284 hypothetical protein (NCBI) (Escherichia coli BW25113)
MFDVLMYLFETYIHTEAELRVDQDKLEQDLTDAGFEREDIYNALLWLEKLADYQEGLAEP
MQLASDPLSMRIYTPEECERLDASCRGFLLFLEQIQVLNLETREMVIERVLALDNAEFEL
DDLKWVILMVLFNIPGCENAYQQMEELLFEVNEGMLH