Protein Info for b3271 in Escherichia coli BW25113

Name: yhdZ
Annotation: predicted amino-acid transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 28 to 176 (149 residues), 135.8 bits, E=1.7e-43

Best Hits

Swiss-Prot: 100% identical to YHDZ_ECOLI: Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ (yhdZ) from Escherichia coli (strain K12)

KEGG orthology group: K09972, general L-amino acid transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to eco:b3271)

MetaCyc: 60% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

See P45769 at UniProt or InterPro

Protein Sequence (252 amino acids)

>b3271 predicted amino-acid transporter subunit (NCBI) (Escherichia coli BW25113)
MSQILLQPANAMITLENVNKWYGQFHVLKNINLTVQPGERIVLCGPSGSGKSTTIRCINH
LEEHQQGRIVVDGIELNEDIRNIERVRQEVGMVFQHFNLFPHLTVLQNCTLAPIWVRKMP
KKEAEDLAVHYLERVRIAEHAHKFPGQISGGQQQRVAIARSLCMKPKIMLFDEPTSALDP
EMVKEVLDTMIGLAQSGMTMLCVTHEMGFARTVADRVIFMDRGEIVEQAAPDEFFAHPKS
ERTRAFLSQVIH