Protein Info for b3262 in Escherichia coli BW25113

Name: yhdJ
Annotation: putative methyltransferase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF01555: N6_N4_Mtase" amino acids 34 to 251 (218 residues), 217.5 bits, see alignment E=2.4e-68

Best Hits

Swiss-Prot: 100% identical to YHDJ_ECOLI: DNA adenine methyltransferase YhdJ (yhdJ) from Escherichia coli (strain K12)

KEGG orthology group: K07319, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 100% identity to eco:b3262)

MetaCyc: 100% identical to DNA adenine methyltransferase (Escherichia coli K-12 substr. MG1655)
Site-specific DNA-methyltransferase (adenine-specific). [EC: 2.1.1.72]

Predicted SEED Role

"Adenine-specific methyltransferase (EC 2.1.1.72)" (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P28638 at UniProt or InterPro

Protein Sequence (294 amino acids)

>b3262 putative methyltransferase (VIMSS) (Escherichia coli BW25113)
MRTGCEPTRFGNEAKTIIHGDALAELKKIPAESVDLIFADPPYNIGKNFDGLIEAWKEDL
FIDWLFEVIAECHRVLKKQGSMYIMNSTENMPFIDLQCRKLFTIKSRIVWSYDSSGVQAK
KHYGSMYEPILMMVKDAKNYTFNGDAILVEAKTGSQRALIDYRKNPPQPYNHQKVPGNVW
DFPRVRYLMDEYENHPTQKPEALLKRIILASSNPGDIVLDPFAGSFTTGAVAIASGRKFI
GIEINSEYIKMGLRRLDVASHYSAEELAKVKKRKTGNLSKRSRLSEVDPDLITK