Protein Info for b3253 in Escherichia coli BW25113

Name: yhdH
Annotation: predicted oxidoreductase, Zn-dependent and NAD(P)-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 121 to 138 (18 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details TIGR02823: putative quinone oxidoreductase, YhdH/YhfP family" amino acids 2 to 323 (322 residues), 476.7 bits, see alignment E=1.3e-147 PF08240: ADH_N" amino acids 27 to 113 (87 residues), 42.8 bits, see alignment E=5.3e-15 PF00107: ADH_zinc_N" amino acids 158 to 281 (124 residues), 55.6 bits, see alignment E=5.7e-19

Best Hits

Swiss-Prot: 100% identical to ACUI_ECOLI: Probable acrylyl-CoA reductase AcuI (acuI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3253)

MetaCyc: 100% identical to acrylyl-CoA reductase (Escherichia coli K-12 substr. MG1655)
RXN-9087 [EC: 1.3.1.84]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.3.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P26646 at UniProt or InterPro

Protein Sequence (324 amino acids)

>b3253 predicted oxidoreductase, Zn-dependent and NAD(P)-binding (NCBI) (Escherichia coli BW25113)
MQALLLEQQDGKTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMI
PGIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARK
AMIIGTAGFTAMLCVMALEDAGVRPQDGEIVVTGASGGVGSTAVALLHKLGYQVVAVSGR
ESTHEYLKSLGASRVLPRDEFAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYGGCVAAC
GLAGGFTLPTTVMPFILRNVRLQGVDSVMTPPERRAQAWQRLVADLPESFYTQAAKEISL
SEAPNFAEAIINNQIQGRTLVKVN