Protein Info for b3242 in Escherichia coli BW25113

Name: yhcR
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details PF07869: DUF1656" amino acids 7 to 61 (55 residues), 71.6 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 100% identical to AAEX_SHIDS: Protein AaeX (aaeX) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: None (inferred from 100% identity to eco:b3242)

Predicted SEED Role

"probable membrane protein YPO3684"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P46478 at UniProt or InterPro

Protein Sequence (67 amino acids)

>b3242 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY
LISRLFV