Protein Info for b3239 in Escherichia coli BW25113
Name: yhcO
Annotation: predicted barnase inhibitor (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
Swiss-Prot: 100% identical to YHCO_ECOL6: Uncharacterized protein YhcO (yhcO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K03623, ribonuclease inhibitor (inferred from 100% identity to eco:b3239)Predicted SEED Role
"probable ribonuclease inhibitor YPO3690"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P64616 at UniProt or InterPro
Protein Sequence (90 amino acids)
>b3239 predicted barnase inhibitor (NCBI) (Escherichia coli BW25113) MNIYTFDFDEIESQEDFYRDFSQTFGLAKDKVRDLDSLWDVLMNDVLPLPLEIEFVHLGE KTRRRFGALILLFDEAEEELEGHLRFNVRH