Protein Info for b3232 in Escherichia coli BW25113

Name: yhcM
Annotation: conserved protein with nucleoside triphosphate hydrolase domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF03969: AFG1_ATPase" amino acids 4 to 371 (368 residues), 584.3 bits, see alignment E=4.4e-180

Best Hits

Swiss-Prot: 100% identical to ZAPE_ECO57: Cell division protein ZapE (zapE) from Escherichia coli O157:H7

KEGG orthology group: K06916, (no description) (inferred from 100% identity to eco:b3232)

Predicted SEED Role

"ATPase, AFG1 family" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P64612 at UniProt or InterPro

Protein Sequence (375 amino acids)

>b3232 conserved protein with nucleoside triphosphate hydrolase domain (NCBI) (Escherichia coli BW25113)
MQSVTPTSQYLKALNEGSHQPDDVQKEAVSRLEIIYQELINSTPPAPRTSGLMARVGKLW
GKREDTKHTPVRGLYMWGGVGRGKTWLMDLFYQSLPGERKQRLHFHRFMLRVHEELTALQ
GQTDPLEIIADRFKAETDVLCFDEFFVSDITDAMLLGGLMKALFARGITLVATSNIPPDE
LYRNGLQRARFLPAIDAIKQHCDVMNVDAGVDYRLRTLTQAHLWLSPLHDETRAQMDKLW
LALAGGKRENSPTLEINHRPLATMGVENQTLAVSFTTLCVDARSQHDYIALSRLFHTVML
FDVPVMTRLMESEARRFIALVDEFYERHVKLVVSAEVPLYEIYQGDRLKFEFQRCLSRLQ
EMQSEEYLKREHLAG