Protein Info for b3227 in Escherichia coli BW25113

Name: dcuD
Annotation: predicted transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 6 to 19 (14 residues), see Phobius details amino acids 26 to 48 (23 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 136 to 174 (39 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details amino acids 436 to 454 (19 residues), see Phobius details PF03606: DcuC" amino acids 2 to 454 (453 residues), 474.6 bits, see alignment E=1.4e-146 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 55 to 444 (390 residues), 676.5 bits, see alignment E=7.1e-208

Best Hits

Swiss-Prot: 100% identical to DCUD_ECOLI: Putative cryptic C4-dicarboxylate transporter DcuD (dcuD) from Escherichia coli (strain K12)

KEGG orthology group: K03326, C4-dicarboxylate transporter, DcuC family (inferred from 100% identity to eco:b3227)

Predicted SEED Role

"Putative cryptic C4-dicarboxylate transporter DcuD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45428 at UniProt or InterPro

Protein Sequence (455 amino acids)

>b3227 predicted transporter (NCBI) (Escherichia coli BW25113)
MFGIIISVIVLITMGYLILKNYKPQVVLAAAGIFLMMCGVWLGFGGVLDPTKSSGYLIVD
IYNEILRMLSNRIAGLGLSIMAVGGYARYMERIGASRAMVSLLSRPLKLIRSPYIILSAT
YVIGQIMAQFITSASGLGMLLMVTLFPTLVSLGVSRLSAVAVIATTMSIEWGILETNSIF
AAQVAGMKIATYFFHYQLPVASCVIISVAISHFFVQRAFDKKDKNINHEQAEQKALDNVP
PLYYAILPVMPLILMLGSLFLAHVGLMQSELHLVVVMLLSLTVTMFVEFFRKHNLRETMD
DVQAFFDGMGTQFANVVTLVVAGEIFAKGLTTIGTVDAVIRGAEHSGLGGIGVMIIMALV
IAICAIVMGSGNAPFMSFASLIPNIAAGLHVPAVVMIMPMHFATTLARAVSPITAVVVVT
SGIAGVSPFAVVKRTAIPMAVGFVVNMIATITLFY