Protein Info for b3214 in Escherichia coli BW25113

Name: gltF
Annotation: periplasmic protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF06551: DUF1120" amino acids 33 to 146 (114 residues), 154.3 bits, see alignment E=7.2e-50

Best Hits

Swiss-Prot: 100% identical to GLTF_ECOLI: Protein GltF (gltF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3214)

Predicted SEED Role

"Beta-fimbriae probable major subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P28721 at UniProt or InterPro

Protein Sequence (254 amino acids)

>b3214 periplasmic protein (NCBI) (Escherichia coli BW25113)
MFFKKNLTTAAICAALSVAAFSAMATDSTDTELTIIGEYTPGACTPVVTGGGIVDYGKHH
NSALNPTGKSNKLVQLGRKNSTLNITCTAPTLIAVTSKDNRQSTIVALNDTSYIEKAYDT
LVDMKGTKNAFGLGSAPNGQKIGAASIGIDRSNGGIHAADDTGEIPVDLIQTDHWSAATP
TWKASSNGAFCSLTSCSAIERGYSVAKTGELTPVAITAVTFPLLIDAAVNDNTILGSDET
IKLDGNVTISVQYL