Protein Info for b3203 in Escherichia coli BW25113

Name: yhbH
Annotation: predicted ribosome-associated, sigma 54 modulation protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 95 (95 residues), 125.8 bits, see alignment E=4.2e-41 PF02482: Ribosomal_S30AE" amino acids 3 to 93 (91 residues), 96.9 bits, see alignment E=5e-32

Best Hits

Swiss-Prot: 100% identical to HPF_ECOL6: Ribosome hibernation promoting factor (hpf) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05808, putative sigma-54 modulation protein (inferred from 100% identity to eco:b3203)

Predicted SEED Role

"Ribosome hibernation protein YhbH" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFX0 at UniProt or InterPro

Protein Sequence (95 amino acids)

>b3203 predicted ribosome-associated, sigma 54 modulation protein (NCBI) (Escherichia coli BW25113)
MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTSDATLHVNGGE
IHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH