Protein Info for b3196 in Escherichia coli BW25113

Name: yrbG
Annotation: predicted calcium/sodium:proton antiporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 106 to 120 (15 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 2 to 312 (311 residues), 354.1 bits, see alignment E=3.1e-110 PF01699: Na_Ca_ex" amino acids 4 to 144 (141 residues), 112.6 bits, see alignment E=8.6e-37 amino acids 175 to 318 (144 residues), 114.5 bits, see alignment E=2.3e-37

Best Hits

Swiss-Prot: 100% identical to YRBG_ECOLI: Inner membrane protein YrbG (yrbG) from Escherichia coli (strain K12)

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to eco:b3196)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45394 at UniProt or InterPro

Protein Sequence (325 amino acids)

>b3196 predicted calcium/sodium:proton antiporter (NCBI) (Escherichia coli BW25113)
MLLATALLIVGLLLVVYSADRLVFAASILCRTFGIPPLIIGMTVVSIGTSLPEVIVSLAA
SLHEQRDLAVGTALGSNIINILLILGLAALVRPFTVHSDVLRRELPLMLLVSVVAGSVLY
DGQLSRSDGIFLLFLAVLWLLFIVKLARQAERQGTDSLTREQLAELPRDGGLPVAFLWLG
IALIIMPVATRMVVDNATVLANYFAISELTMGLTAIAIGTSLPELATAIAGVRKGENDIA
VGNIIGANIFNIVIVLGLPALITPGEIDPLAYSRDYSVMLLVSIIFALLCWRRSPQPGRG
VGVLLTGGFIVWLAMLYWLSPILVE