Protein Info for b3194 in Escherichia coli BW25113

Name: yrbE
Annotation: predicted toluene transporter subunit: membrane component of ABC superfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 48 to 81 (34 residues), see Phobius details amino acids 86 to 96 (11 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 148 to 175 (28 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 5 to 258 (254 residues), 355.2 bits, see alignment E=1.2e-110 PF02405: MlaE" amino acids 45 to 256 (212 residues), 239.8 bits, see alignment E=1.2e-75

Best Hits

Swiss-Prot: 100% identical to MLAE_ECO57: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Escherichia coli O157:H7

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to eco:b3194)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P64606 at UniProt or InterPro

Protein Sequence (260 amino acids)

>b3194 predicted toluene transporter subunit: membrane component of ABC superfamily (NCBI) (Escherichia coli BW25113)
MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV
VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI
GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI
DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV
HSSLAVLGLDFVLTALMFGN