Protein Info for b3188 in Escherichia coli BW25113

Name: sfsB
Annotation: DNA-binding transcriptional activator of maltose metabolism (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 PF13693: HTH_35" amino acids 7 to 81 (75 residues), 118.4 bits, see alignment E=5.3e-39

Best Hits

Swiss-Prot: 100% identical to SFSB_SHIFL: Sugar fermentation stimulation protein B (sfsB) from Shigella flexneri

KEGG orthology group: K07724, Ner family transcriptional regulator (inferred from 100% identity to eco:b3188)

Predicted SEED Role

"Ner-like regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACH1 at UniProt or InterPro

Protein Sequence (92 amino acids)

>b3188 DNA-binding transcriptional activator of maltose metabolism (NCBI) (Escherichia coli BW25113)
MESNFIDWHPADIIAGLRKKGTSMAAESRRNGLSSSTLANALSRPWPKGEMIIAKALGTD
PWVIWPSRYHDPQTHEFIDRTQLMRSYTKPKK