Protein Info for b3161 in Escherichia coli BW25113

Name: mtr
Annotation: tryptophan transporter of high affinity (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 190 to 207 (18 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 10 to 402 (393 residues), 525.2 bits, see alignment E=6e-162 TIGR00837: aromatic amino acid transport protein" amino acids 15 to 395 (381 residues), 535.7 bits, see alignment E=3.9e-165

Best Hits

Swiss-Prot: 100% identical to MTR_ECOLI: Tryptophan-specific transport protein (mtr) from Escherichia coli (strain K12)

KEGG orthology group: K03835, tryptophan-specific transport protein (inferred from 100% identity to eco:b3161)

MetaCyc: 100% identical to tryptophan:H+ symporter Mtr (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-142; TRANS-RXN-76

Predicted SEED Role

"Tryptophan-specific transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAD2 at UniProt or InterPro

Protein Sequence (414 amino acids)

>b3161 tryptophan transporter of high affinity (NCBI) (Escherichia coli BW25113)
MATLTTTQTSPSLLGGVVIIGGTIIGAGMFSLPVVMSGAWFFWSMAALIFTWFCMLHSGL
MILEANLNYRIGSSFDTITKDLLGKGWNVVNGISIAFVLYILTYAYISASGSILHHTFAE
MSLNVPARAAGFGFALLVAFVVWLSTKAVSRMTAIVLGAKVITFFLTFGSLLGHVQPATL
FNVAESNASYAPYLLMTLPFCLASFGYHGNVPSLMKYYGKDPKTIVKCLVYGTLMALALY
TIWLLATMGNIPRPEFIGIAEKGGNIDVLVQALSGVLNSRSLDLLLVVFSNFAVASSFLG
VTLGLFDYLADLFGFDDSAVGRLKTALLTFAPPVVGGLLFPNGFLYAIGYAGLAATIWAA
IVPALLARASRKRFGSPKFRVWGGKPMIALILVFGVGNALVHILSSFNLLPVYQ