Protein Info for b3148 in Escherichia coli BW25113
Name: yraN
Annotation: hypothetical protein (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to YRAN_ECOLC: UPF0102 protein YraN (yraN) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
KEGG orthology group: K07460, putative endonuclease (inferred from 100% identity to eco:b3148)Predicted SEED Role
"Endonuclease (EC 3.1.-.-)" (EC 3.1.-.-)
Isozymes
Compare fitness of predicted isozymes for: 3.1.-.-
Use Curated BLAST to search for 3.1.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P45465 at UniProt or InterPro
Protein Sequence (131 amino acids)
>b3148 hypothetical protein (NCBI) (Escherichia coli BW25113) MATVPTRSGSPRQLTTKQTGDAWEAQARRWLEGKGLRFIAANVNERGGEIDLIMREGRTT IFVEVRYRRSALYGGAAASVTRSKQHKLLQTARLWLARHNGSFDTVDCRFDVVAFTGNEV EWIKDAFNDHS