Protein Info for b3140 in Escherichia coli BW25113

Name: agaD
Annotation: N-acetylgalactosamine-specific enzyme IID component of PTS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 96 to 119 (24 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details TIGR00828: PTS system, mannose/fructose/sorbose family, IID component" amino acids 4 to 263 (260 residues), 416.4 bits, see alignment E=2.4e-129 PF03613: EIID-AGA" amino acids 5 to 263 (259 residues), 308.7 bits, see alignment E=1.5e-96

Best Hits

Swiss-Prot: 100% identical to PTPD_ECOLI: N-acetylgalactosamine permease IID component (agaD) from Escherichia coli (strain K12)

KEGG orthology group: K10986, PTS system, galactosamine-specific IID component (inferred from 100% identity to eco:b3140)

MetaCyc: 36% identical to ribitol PTS component EIID (Lacticaseibacillus casei)
2.7.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P42911 at UniProt or InterPro

Protein Sequence (263 amino acids)

>b3140 N-acetylgalactosamine-specific enzyme IID component of PTS (NCBI) (Escherichia coli BW25113)
MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKDDKPGLSAAMKDN
LEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAG
ICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATIL
GITVIGGLIASYVHINVVTSFAIDNTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKK
AHPVLLIGVTFVLSIVCSAFGIL