Protein Info for b3139 in Escherichia coli BW25113

Name: agaC
Annotation: N-acetylgalactosamine-specific enzyme IIC component of PTS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 24 (13 residues), see Phobius details amino acids 30 to 53 (24 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 209 to 238 (30 residues), see Phobius details TIGR00822: PTS system, mannose/fructose/sorbose family, IIC component" amino acids 2 to 267 (266 residues), 410.8 bits, see alignment E=1.1e-127 PF03609: EII-Sor" amino acids 7 to 238 (232 residues), 230 bits, see alignment E=1.4e-72

Best Hits

Swiss-Prot: 100% identical to PTPC1_ECOLI: N-acetylgalactosamine permease IIC component 1 (agaC) from Escherichia coli (strain K12)

KEGG orthology group: K10985, PTS system, galactosamine-specific IIC component (inferred from 100% identity to eco:b3139)

Predicted SEED Role

"PTS system, galactosamine-specific IIC component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P42910 at UniProt or InterPro

Protein Sequence (267 amino acids)

>b3139 N-acetylgalactosamine-specific enzyme IIC component of PTS (NCBI) (Escherichia coli BW25113)
MHEITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELA
FAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSL
FMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTYLAQGAMQALVKAMPAWLTH
GFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVYEF
FNAKSRQQAQPQPVASKNEEEDYSNGI