Protein Info for b3136 in Escherichia coli BW25113

Name: agaS
Annotation: tagatose-6-phosphate ketose/aldose isomerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02815: putative sugar isomerase, AgaS family
  • amino acids 13 to 382 (370 residues), 634.7 bits, E=2.3e-195
• PF01380: SIS
  • amino acids 49 to 187 (139 residues), 77.2 bits, E=5.3e-26
  • amino acids 222 to 357 (136 residues), 67.3 bits, E=6.1e-23

Best Hits

Swiss-Prot: 100% identical to AGAS_ECOLI: Putative D-galactosamine-6-phosphate deaminase AgaS (agaS) from Escherichia coli (strain K12)

KEGG orthology group: K02082, tagatose-6-phosphate ketose/aldose isomerase [EC: 5.-.-.-] (inferred from 100% identity to eco:b3136)

MetaCyc: 99% identical to D-galactosamine-6-phosphate deaminase/isomerase (Escherichia coli O157:H7)
3.5.99.-

Predicted SEED Role

"Galactosamine-6-phosphate isomerase (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)

MetaCyc Pathways

• D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
• N-acetyl-D-galactosamine degradation (4/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Galactose metabolism
• Inositol phosphate metabolism
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.-

Sequence Analysis Tools

See P42907 at UniProt or InterPro

Protein Sequence (384 amino acids)

>b3136 tagatose-6-phosphate ketose/aldose isomerase (NCBI) (Escherichia coli BW25113)
MPENYTPAAAATGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRKENLRIILTG
AGTSAFIGDIIAPWLASHTGKNFSAVPTTDLVTNPMDYLNPAHPLLLISFGRSGNSPESV
AAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLMPAETHDRGFAMTSSITTMM
ASCLAVFAPETINSQTFRDVADRCQAILTSLGDFSEGVFGYAPWKRIVYLGSGGLQGAAR
ESALKVLELTAGKLAAFYDSPTGFRHGPKSLVDDETLVVVFVSSHPYTRQYDLDLLAELR
RDNQAMRVIAIAAESSDIVAAGPHIILPPSRHFIDVEQAFCFLMYAQTFALMQSLHMGNT
PDTPSASGTVNRVVQGVIIHPWQA