Protein Info for b3131 in Escherichia coli BW25113

Name: agaR
Annotation: DNA-binding transcriptional dual regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF08279: HTH_11" amino acids 18 to 64 (47 residues), 35.9 bits, see alignment 8.1e-13 PF08220: HTH_DeoR" amino acids 18 to 74 (57 residues), 75.2 bits, see alignment E=4.1e-25 PF00455: DeoRC" amino acids 89 to 247 (159 residues), 186.4 bits, see alignment E=5.4e-59

Best Hits

Swiss-Prot: 100% identical to AGAR_ECOL6: Putative aga operon transcriptional repressor (agaR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02081, DeoR family transcriptional regulator, aga operon transcriptional repressor (inferred from 100% identity to eco:b3131)

Predicted SEED Role

"Transcriptional repressor of aga operon" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACK2 at UniProt or InterPro

Protein Sequence (269 amino acids)

>b3131 DNA-binding transcriptional dual regulator (NCBI) (Escherichia coli BW25113)
MSNTDASGEKRVTGTSERREQIIQRLRQQGSVQVNDLSALYGVSTVTIRNDLAFLEKQGI
AVRAYGGALICDSTTPSVEPSVEDKSALNTAMKRSVAKAAVELIQPGHRVILDSGTTTFE
IARLMRKHTDVIAMTNGMNVANALLEAEGVELLMTGGHLRRQSQSFYGDQAEQSLQNYHF
DMLFLGVDAIDLERGVSTHNEDEARLNRRMCEVAERIIVVTDSSKFNRSSLHKIIDTQRI
DMIIVDEGIPADSLEGLRKAGVEVILVGE