Protein Info for b3127 in Escherichia coli BW25113

Name: garP
Annotation: predicted (D)-galactarate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 86 to 124 (39 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 380 to 406 (27 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 315 (293 residues), 156.1 bits, see alignment E=1.2e-49 amino acids 324 to 433 (110 residues), 35.4 bits, see alignment E=6.2e-13 TIGR00893: D-galactonate transporter" amino acids 25 to 434 (410 residues), 456.6 bits, see alignment E=3.7e-141

Best Hits

Swiss-Prot: 100% identical to GARP_ECOLI: Probable galactarate transporter (garP) from Escherichia coli (strain K12)

KEGG orthology group: K12299, MFS transporter, ACS family, probable galactarate transporter (inferred from 100% identity to eco:b3127)

MetaCyc: 100% identical to galactarate/D-glucarate transporter GarP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AA80 at UniProt or InterPro

Protein Sequence (444 amino acids)

>b3127 predicted (D)-galactarate transporter (NCBI) (Escherichia coli BW25113)
MILDTVDEKKKGVHTRYLILLIIFIVTAVNYADRATLSIAGTEVAKELQLSAVSMGYIFS
AFGWAYLLMQIPGGWLLDKFGSKKVYTYSLFFWSLFTFLQGFVDMFPLAWAGISMFFMRF
MLGFSEAPSFPANARIVAAWFPTKERGTASAIFNSAQYFSLALFSPLLGWLTFAWGWEHV
FTVMGVIGFVLTALWIKLIHNPTDHPRMSAEELKFISENGAVVDMDHKKPGSAAASGPKL
HYIKQLLSNRMMLGVFFGQYFINTITWFFLTWFPIYLVQEKGMSILKVGLVASIPALCGF
AGGVLGGVFSDYLIKRGLSLTLARKLPIVLGMLLASTIILCNYTNNTTLVVMLMALAFFG
KGFGALGWPVISDTAPKEIVGLCGGVFNVFGNVASIVTPLVIGYLVSELHSFNAALVFVG
CSALMAMVCYLFVVGDIKRMELQK