Protein Info for b3124 in Escherichia coli BW25113

Name: garK
Annotation: glycerate kinase I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00045: glycerate kinase
  • amino acids 2 to 375 (374 residues), 580.1 bits, E=9.6e-179
• PF02595: Gly_kinase
  • amino acids 3 to 373 (371 residues), 524.9 bits, E=5.3e-162

Best Hits

Swiss-Prot: 100% identical to GLXK1_ECOLI: Glycerate 2-kinase (garK) from Escherichia coli (strain K12)

KEGG orthology group: K00865, glycerate kinase [EC: 2.7.1.31] (inferred from 100% identity to eco:b3124)

MetaCyc: 100% identical to glycerate 2-kinase 1 (Escherichia coli K-12 substr. MG1655)
GKI-RXN [EC: 2.7.1.165]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of glycol metabolism and degradation (7/7 steps found)
• superpathway of D-glucarate and D-galactarate degradation (5/5 steps found)
• D-glucarate degradation I (4/4 steps found)
• D-galactarate degradation I (4/4 steps found)
• glycolate and glyoxylate degradation I (4/4 steps found)
• 2-O-α-mannosyl-D-glycerate degradation (2/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• photorespiration II (6/10 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.31

Use Curated BLAST to search for 2.7.1.165 or 2.7.1.31

Sequence Analysis Tools

See P23524 at UniProt or InterPro

Protein Sequence (381 amino acids)

>b3124 glycerate kinase I (RefSeq) (Escherichia coli BW25113)
MKIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAE
RHAWVTGPLGEKVNASWGISGDGKTAFIEMAAASGLELVPAEKRDPLVTTSRGTGELILQ
ALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLNDIDISGLD
PRLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVIKKALHVD
VKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRIDSQSI
HGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFRGAYD
NICRASRNIAATLAIGMRNAG