Protein Info for b3090 in Escherichia coli BW25113

Name: ygjV
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 98 to 124 (27 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details PF10688: Imp-YgjV" amino acids 5 to 163 (159 residues), 202 bits, see alignment E=2.5e-64

Best Hits

Swiss-Prot: 100% identical to YGJV_ECOLI: Inner membrane protein YgjV (ygjV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3090)

Predicted SEED Role

"Inner membrane protein ygjV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P42603 at UniProt or InterPro

Protein Sequence (183 amino acids)

>b3090 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MTAYWLAQGVGVIAFLIGITTFFNRDERRFKKQLSVYSAVIGVHFFLLGTYPAGASAILN
AIRTLITLRTRSLWVMAIFIVLTGGIGLAKFHHPVELLPVIGTIVSTWALFCCKGLTMRC
VMWFSTCCWVIHNFWAGSIGGTMIEGSFLLMNGLNIIRFWRMQKRGIDPFKVEKTPSAVD
ERG