Protein Info for b3089 in Escherichia coli BW25113

Name: sstT
Annotation: sodium:serine/threonine symporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 43 to 71 (29 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 327 to 352 (26 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details PF00375: SDF" amino acids 18 to 398 (381 residues), 220.6 bits, see alignment E=1.8e-69

Best Hits

Swiss-Prot: 100% identical to SSTT_SHISS: Serine/threonine transporter SstT (sstT) from Shigella sonnei (strain Ss046)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 100% identity to eco:b3089)

MetaCyc: 100% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGE4 at UniProt or InterPro

Protein Sequence (414 amino acids)

>b3089 sodium:serine/threonine symporter (NCBI) (Escherichia coli BW25113)
MTTQRSPGLFRRLAHGSLVKQILVGLVLGILLAWISKPAAEAVGLLGTLFVGALKAVAPI
LVLMLVMASIANHQHGQKTNIRPILFLYLLGTFSAALAAVVFSFAFPSTLHLSSSAGDIS
PPSGIVEVMRGLVMSMVSNPIDALLKGNYIGILVWAIGLGFALRHGNETTKNLVNDMSNA
VTFMVKLVIRFAPIGIFGLVSSTLATTGFSTLWGYAQLLVVLVGCMLLVALVVNPLLVWW
KIRRNPFPLVLLCLRESGVYAFFTRSSAANIPVNMALCEKLNLDRDTYSVSIPLGATINM
AGAAITITVLTLAAVNTLGIPVDLPTALLLSVVASLCACGASGVAGGSLLLIPLACNMFG
ISNDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAACQAEDDRLANSALRN