Protein Info for b3071 in Escherichia coli BW25113

Name: yqjI
Annotation: predicted transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF03551: PadR" amino acids 67 to 136 (70 residues), 55.9 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 100% identical to YQJI_SHIFL: Uncharacterized protein YqjI (yqjI) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b3071)

Predicted SEED Role

"Transcriptional regulator, PadR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P64588 at UniProt or InterPro

Protein Sequence (207 amino acids)

>b3071 predicted transcriptional regulator (NCBI) (Escherichia coli BW25113)
MSHHHEGCCKHEGQPRHEGCCKGEKSEHEHCGHGHQHEHGQCCGGRHGRGGGRRQRFFGH
GELRLVILDILSRDDSHGYELIKAIENLTQGNYTPSPGVIYPTLDFLQEQSLITIREEEG
GKKQIALTEQGAQWLEENREQVEMIEERIKARCVGAALRQNPQMKRALDNFKAVLDLRVN
QSDISDAQIKKIIAVIDRAAFDITQLD