Protein Info for b3062 in Escherichia coli BW25113

Name: ttdB
Annotation: L(+)-tartrate dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05683: Fumerase_C
  • amino acids 6 to 175 (170 residues), 136.9 bits, E=3.1e-44
• TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  • amino acids 12 to 176 (165 residues), 256.8 bits, E=4.7e-81

Best Hits

Swiss-Prot: 100% identical to TTDB_ECOUT: L(+)-tartrate dehydratase subunit beta (ttdB) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K03780, L(+)-tartrate dehydratase beta subunit [EC: 4.2.1.32] (inferred from 100% identity to eco:b3062)

MetaCyc: 100% identical to L(+)-tartrate dehydratase subunit beta (Escherichia coli K-12 substr. MG1655)
L(+)-tartrate dehydratase. [EC: 4.2.1.32]

Predicted SEED Role

"L(+)-tartrate dehydratase beta subunit (EC 4.2.1.32)" (EC 4.2.1.32)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.32

Use Curated BLAST to search for 4.2.1.32

Sequence Analysis Tools

See P0AC35 at UniProt or InterPro

Protein Sequence (201 amino acids)

>b3062 L(+)-tartrate dehydratase (NCBI) (Escherichia coli BW25113)
MKKILTTPIKAEDLQDIRVGDVIYLTGTLVTCRDVCHRRLIELKRPIPYDLNGKAIFHAG
PIVRKNGDKWEMVSVGPTTSMRMESFEREFIEQTGVKLVVGKGGMGPLTEEGCQKFKALH
VIFPAGCAVLAATQVEEIEEVHWTELGMPESLWVCRVKEFGPLIVSIDTHGNNLIAENKK
LFAERRDPIVEEICEHVHYIK