Protein Info for b3032 in Escherichia coli BW25113

Name: cpdA
Annotation: cyclic 3',5'-adenosine monophosphate phosphodiesterase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00149: Metallophos
  • amino acids 16 to 206 (191 residues), 80.8 bits, E=1.9e-26
• PF12850: Metallophos_2
  • amino acids 16 to 213 (198 residues), 28.7 bits, E=1.3e-10

Best Hits

Swiss-Prot: 100% identical to CPDA_ECO57: 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA (cpdA) from Escherichia coli O157:H7

KEGG orthology group: K03651, Icc protein (inferred from 100% identity to eco:b3032)

MetaCyc: 100% identical to cAMP phosphodiesterase (Escherichia coli K-12 substr. MG1655)
3',5'-cyclic-AMP phosphodiesterase. [EC: 3.1.4.53]

Predicted SEED Role

"3',5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)" in subsystem cAMP signaling in bacteria (EC 3.1.4.17)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.17 or 3.1.4.53

Sequence Analysis Tools

See P0AEW4 at UniProt or InterPro

Protein Sequence (275 amino acids)

>b3032 cyclic 3',5'-adenosine monophosphate phosphodiesterase (NCBI) (Escherichia coli BW25113)
MESLLTLPLAGEARVRILQITDTHLFAQKHEALLGVNTWESYQAVLEAIRPHQHEFDLIV
ATGDLAQDQSSAAYQHFAEGIASFRAPCVWLPGNHDFQPAMYSALQDAGISPAKRVFIGE
QWQILLLDSQVFGVPHGELSEFQLEWLERKLADAPERHTLLLLHHHPLPAGCSWLDQHSL
RNAGELDTVLAKFPHVKYLLCGHIHQELDLDWNGRRLLATPSTCVQFKPHCSNFTLDTIA
PGWRTLELHADGTLTTEVHRLADTRFQPDTASEGY