Protein Info for b3006 in Escherichia coli BW25113

Name: exbB
Annotation: membrane spanning protein in TonB-ExbB-ExbD complex (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 11 to 222 (212 residues), 343.8 bits, see alignment E=2e-107 PF01618: MotA_ExbB" amino acids 97 to 203 (107 residues), 111.9 bits, see alignment E=8.7e-37

Best Hits

Swiss-Prot: 100% identical to EXBB_ECO57: Biopolymer transport protein ExbB (exbB) from Escherichia coli O157:H7

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to eco:b3006)

MetaCyc: 100% identical to Ton complex subunit ExbB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABU7 at UniProt or InterPro

Protein Sequence (244 amino acids)

>b3006 membrane spanning protein in TonB-ExbB-ExbD complex (NCBI) (Escherichia coli BW25113)
MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQ
LLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVA
AVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA
TAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQK
LRAG