Protein Info for b2993 in Escherichia coli BW25113

Name: hybD
Annotation: predicted maturation element for hydrogenase 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR00140: hydrogenase expression/formation protein" amino acids 3 to 153 (151 residues), 185.4 bits, see alignment E=6e-59 TIGR00072: hydrogenase maturation protease" amino acids 4 to 148 (145 residues), 154.5 bits, see alignment E=2e-49 PF01750: HycI" amino acids 20 to 147 (128 residues), 131.3 bits, see alignment E=9.9e-43

Best Hits

Swiss-Prot: 100% identical to HYBD_ECOLI: Hydrogenase 2 maturation protease (hybD) from Escherichia coli (strain K12)

KEGG orthology group: K08567, hydrogenase 2 maturation protease [EC: 3.4.24.-] (inferred from 100% identity to eco:b2993)

MetaCyc: 100% identical to hydrogenase 2 maturation protease (Escherichia coli K-12 substr. MG1655)
RXN-22655 [EC: 3.4.23.51]

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.23.51 or 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37182 at UniProt or InterPro

Protein Sequence (164 amino acids)

>b2993 predicted maturation element for hydrogenase 2 (NCBI) (Escherichia coli BW25113)
MRILVLGVGNILLTDEAIGVRIVEALEQRYILPDYVEILDGGTAGMELLGDMANRDHLII
ADAIVSKKNAPGTMMILRDEEVPALFTNKISPHQLGLADVLSALRFTGEFPKKLTLVGVI
PESLEPHIGLTPTVEAMIEPALEQVLAALRESGVEAIPREAIHD