Protein Info for b2991 in Escherichia coli BW25113

Name: hybF
Annotation: protein involved with the maturation of hydrogenases 1 and 2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 TIGR00100: hydrogenase nickel insertion protein HypA" amino acids 1 to 113 (113 residues), 148.7 bits, see alignment E=3.5e-48 PF01155: HypA" amino acids 1 to 112 (112 residues), 115.2 bits, see alignment E=8.3e-38

Best Hits

Swiss-Prot: 100% identical to HYBF_ECOLI: Hydrogenase maturation factor HybF (hybF) from Escherichia coli (strain K12)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 100% identity to eco:b2991)

MetaCyc: 48% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HybF" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A703 at UniProt or InterPro

Protein Sequence (113 amino acids)

>b2991 protein involved with the maturation of hydrogenases 1 and 2 (NCBI) (Escherichia coli BW25113)
MHELSLCQSAVEIIQRQAEQHDVKRVTAVWLEIGALSCVEESAVRFSFEIVCHGTVAQGC
DLHIVYKPAQAWCWDCSQVVEIHQHDAQCPLCHGERLRVDTGDSLIVKSIEVE