Protein Info for b2984 in Escherichia coli BW25113

Name: yghR
Annotation: predicted protein with nucleoside triphosphate hydrolase domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 96 to 113 (18 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to YGHR_ECOLI: Uncharacterized ATP-binding protein YghR (yghR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2984)

Predicted SEED Role

"Conserved protein YghR, with nucleoside triphosphate hydrolase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P64572 at UniProt or InterPro

Protein Sequence (252 amino acids)

>b2984 predicted protein with nucleoside triphosphate hydrolase domain (NCBI) (Escherichia coli BW25113)
MDALQTQTVNSTTAPQPNYIPGLIAVVGCDGTGKSTLTTDLVKSLQQHWQTERRYLGLLS
GEDGDKIKRLPLVGVWLERRLAAKSSKTQSMKTKSPALWAAVIMYCFSLRRMANLRKVQR
LAQSGVLVVSDRFPQAEISGFYYDGPGIGVERATGKISMFLAQRERRLYQQMAQYRPELI
IRLGIDIETAISRKPDHDYAELQDKIGVMSKIGYNGTKILEIDSRAPYSEVLEQAQKAVS
LVAIVSDRRSLT