Protein Info for b2980 in Escherichia coli BW25113

Name: glcC
Annotation: DNA-binding transcriptional dual regulator, glycolate-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00392: GntR" amino acids 11 to 69 (59 residues), 50.3 bits, see alignment E=1.5e-17 PF07729: FCD" amino acids 96 to 226 (131 residues), 81 bits, see alignment E=1e-26

Best Hits

Swiss-Prot: 100% identical to GLCC_ECOL6: Glc operon transcriptional activator (glcC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11474, GntR family transcriptional regulator, glc operon transcriptional activator (inferred from 100% identity to eco:b2980)

Predicted SEED Role

"Glycolate utilization operon transcriptional activator GlcC" in subsystem Glycolate, glyoxylate interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACL5 at UniProt or InterPro

Protein Sequence (254 amino acids)

>b2980 DNA-binding transcriptional dual regulator, glycolate-binding (NCBI) (Escherichia coli BW25113)
MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGI
IETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQAD
FVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNS
VFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGH
HLIRSAVPLEMNLS