Protein Info for b2975 in Escherichia coli BW25113

Name: yghK
Annotation: glycolate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 66 to 92 (27 residues), see Phobius details amino acids 118 to 148 (31 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 331 to 348 (18 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details amino acids 439 to 464 (26 residues), see Phobius details amino acids 537 to 558 (22 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 6 to 552 (547 residues), 780.9 bits, see alignment E=3.4e-239 PF02652: Lactate_perm" amino acids 16 to 550 (535 residues), 690 bits, see alignment E=1.2e-211

Best Hits

Swiss-Prot: 100% identical to GLCA_ECOLI: Glycolate permease GlcA (glcA) from Escherichia coli (strain K12)

KEGG orthology group: K02550, glycolate permease (inferred from 100% identity to eco:b2975)

MetaCyc: 100% identical to glycolate/lactate:H+ symporter GlcA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-104; TRANS-RXN-105; TRANS-RXN0-515; TRANS-RXN0-622

Predicted SEED Role

"Glycolate permease" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46839 at UniProt or InterPro

Protein Sequence (560 amino acids)

>b2975 glycolate transporter (NCBI) (Escherichia coli BW25113)
MVTWTQMYMPMGGLGLSALVALIPIIFFFVALAVLRLKGHVAGAITLILSILIAIFAFKM
PIDMAFAAAGYGFIYGLWPIAWIIVAAVFLYKLTVASGQFDIIRSSVISITDDQRLQVLL
IGFSFGALLEGAAGFGAPVAITGALLVGLGFKPLYAAGLCLIANTAPVAFGALGVPILVA
GQVTGIDPFHIGAMAGRQLPFLSVLVPFWLVAMMDGWKGVKETWPAALVAGGSFAVTQFF
TSNYIGPELPDITSALVSIVSLALFLKVWRPKNTETAISMGQSAGAMVVNKPSSGGPVPS
EYSLGQIIRAWSPFLILTVLVTIWTMKPFKALFAPGGAFYSLVINFQIPHLHQQVLKAAP
IVAQPTPMDAVFKFDPLSAGGTAIFIAAIISIFILGVGIKKGIGVFAETLISLKWPILSI
GMVLAFAFVTNYSGMSTTLALVLAGTGVMFPFFSPFLGWLGVFLTGSDTSSNALFGSLQS
TTAQQINVSDTLLVAANTSGGVTGKMISPQSIAVACAATGMVGRESELFRYTVKHSLIFA
SVIGIITLLQAYVFTGMLVS