Protein Info for b2972 in Escherichia coli BW25113

Name: b2972
Annotation: putative peptidase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 210 to 241 (32 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details PF06750: A24_N_bact" amino acids 21 to 118 (98 residues), 116.6 bits, see alignment E=4.3e-38 PF01478: Peptidase_A24" amino acids 130 to 240 (111 residues), 85.9 bits, see alignment E=2.4e-28

Best Hits

Swiss-Prot: 100% identical to PPPA_ECOLI: Prepilin peptidase PppA (pppA) from Escherichia coli (strain K12)

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 100% identity to eco:b2972)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46836 at UniProt or InterPro

Protein Sequence (269 amino acids)

>b2972 putative peptidase (VIMSS) (Escherichia coli BW25113)
MLFDVFQQYPTAMPVLATVGGLIIGSFLNVVIWRYPIMLRQQMAEFHGEMSSAQSKISLA
LPRSHCPHCQQTIRIRDNIPLFSWLMLKGRCRDCQAKISKRYPLVELLTALAFLLASLVW
PESGWGLAVMILSAWLIAASVIDLDHQWLPDVFTQGVLWTGLIAAWAQQSPLTLQDAVTG
VLVGFITFYSLRWIAGIVLRKEALGMGDVLLFAALGGWVGALSLPNVALIASCCGLIYAV
ITKRGSTTLPFGPCLSLGGIATLYLQALF