Protein Info for b2968 in Escherichia coli BW25113

Name: yghD
Annotation: predicted secretion pathway M-type protein, membrane anchored (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details PF04612: T2SSM" amino acids 24 to 177 (154 residues), 155.7 bits, see alignment E=5.8e-50

Best Hits

Swiss-Prot: 100% identical to YGHD_ECOLI: Putative type II secretion system M-type protein YghD (yghD) from Escherichia coli (strain K12)

KEGG orthology group: K02462, general secretion pathway protein M (inferred from 100% identity to eco:b2968)

Predicted SEED Role

"General secretion pathway protein M"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46832 at UniProt or InterPro

Protein Sequence (178 amino acids)

>b2968 predicted secretion pathway M-type protein, membrane anchored (NCBI) (Escherichia coli BW25113)
MLRDKFIHYFQQWRERQLSRGEHWLAQHLAGRSPREKGMLLAAVVFLFSVGYYVLIWQPL
SERIEQQETILQQLVAMNTRLKNAAPDIIAARKSATTTPAQVSRVISDSASAHSVVIRRI
ADRGENIQVWIEPVVFNDLLKWLNALDEKYALRVTQIDVSAAEKPGMVNVQRLEFGRG