Protein Info for b2966 in Escherichia coli BW25113

Name: yqgA
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details PF04474: DUF554" amino acids 3 to 227 (225 residues), 229 bits, see alignment E=2.5e-72

Best Hits

Swiss-Prot: 100% identical to YQGA_ECOLI: Uncharacterized protein YqgA (yqgA) from Escherichia coli (strain K12)

KEGG orthology group: K07150, (no description) (inferred from 100% identity to eco:b2966)

Predicted SEED Role

"Putative inner membrane protein YqgA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46831 at UniProt or InterPro

Protein Sequence (235 amino acids)

>b2966 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MVIGPFINASAVLLGGVLGALLSQRLPERIRVSMTSIFGLASLGIGILLVVKCANLPAMV
LATLLGALIGEICLLEKGVNTAVAKAQNLFRHSRKKPAHESFIQNYVAIIVLFCASGTGI
FGAMNEGMTGDPSILIAKSFLDFFTAMIFACSLGIAVSVISIPLLIIQLTLAWAAALILP
LTTPSMMADFSAVGGLLLLATGLRICGIKMFPVVNMLPALLLAMPLSAAWTAWFA