Protein Info for b2964 in Escherichia coli BW25113

Name: nupG
Annotation: transport of nucleosides, permease protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 1 to 406 (406 residues), 627.6 bits, see alignment E=1.4e-192 TIGR00889: nucleoside transporter" amino acids 1 to 418 (418 residues), 748 bits, see alignment E=1.6e-229 PF12832: MFS_1_like" amino acids 6 to 370 (365 residues), 90.8 bits, see alignment E=1.6e-29 PF07690: MFS_1" amino acids 252 to 403 (152 residues), 39.2 bits, see alignment E=6.2e-14

Best Hits

Swiss-Prot: 100% identical to NUPG_SHIFL: Nucleoside permease NupG (nupG) from Shigella flexneri

KEGG orthology group: K03289, MFS transporter, NHS family, nucleoside permease (inferred from 100% identity to eco:b2964)

MetaCyc: 100% identical to nucleoside:H+ symporter NupG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-108A; TRANS-RXN-108B; TRANS-RXN-108C; TRANS-RXN-108D; TRANS-RXN-108E; TRANS-RXN-108G; TRANS-RXN-108H; TRANS-RXN-108I; TRANS-RXN-474; TRANS-RXN-475; TRANS-RXN-476

Predicted SEED Role

"Nucleoside permease NupG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFF4 at UniProt or InterPro

Protein Sequence (418 amino acids)

>b2964 transport of nucleosides, permease protein (VIMSS) (Escherichia coli BW25113)
MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPALLGI
VADKWLSAKWVYAICHTIGAITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYR
LQNAGMDIVTDFPPIRIWGTIGFIMAMWVVSLSGFELSHMQLYIGAALSAILVLFTLTLP
HIPVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNTFLHSFDK
DPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWILRFALFAY
GDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMMTNGFGCIL
GGIVSGKVVEMYTQNGITDWQTVWLIFAGYSVVLAFAFMAMFKYKHVRVPTGTQTVSH